LL-37

LL-37 is the 37-residue C-terminal fragment of the human cathelicidin precursor protein hCAP18, the single cathelicidin encoded by the human CAMP gene, with the sequence [LL-37, 37 aa] It is listed here strictly as an analytical reference entity — it is not sold, stocked, or certified by Lineará, and has no price or certificate of analysis. The data on this page is characterization only: molecular formula C205H340N60O53 and the values computed from it. No biological activity, mechanism, or use is described or implied.

LL-37 has the sequence [LL-37, 37 aa] LL-37 is the 37-residue C-terminal fragment of the human cathelicidin precursor protein hCAP18 (UniProt P49913, residues 134–170; feature PRO_0000004724) — the single cathelicidin encoded by the human CAMP gene. Its single-letter sequence [LL-37, 37 aa] contains no cysteine or methionine, so the molecular formula C205H340N60O53 carries no sulfur; the C-terminus is the free acid. As a 37-residue peptide it is represented here by its sequence and molecular formula rather than a small-molecule InChIKey — the convention Lineará applies to large peptides. Molecular identity is reconciled against PubChem CID 16198951, whose curated molecular formula the sequence reproduces exactly (thirty-nine stereocentres, none unassigned); the name reflects the two N-terminal leucines and the 37-residue length.

LL-37 has the molecular formula C205H340N60O53, giving an average molecular weight of 4493.34 g/mol and a computed monoisotopic mass of 4490.5754 Da.

The CAS Registry Number for LL-37 is 154947-66-7. Its PubChem CID is 16198951, its FDA UNII is 3DD771JO2H, and its InChIKey is POIUWJQBRNEFGX-XAMSXPGMSA-N.

Yes. LL-37 is a peptide — a chain of amino-acid residues joined by peptide bonds, 37 residues in length. Its identity is defined by that sequence and its molecular mass.

As a research material, LL-37 is typically handled as a lyophilized (freeze-dried) powder. It is kept desiccated and cold — commonly 2–8 °C for short periods and −20 °C for longer storage — and reconstituted in sterile or bacteriostatic water. This is storage and handling information only, not a use protocol.

No. LL-37 is listed here only as an analytical reference entity. It is not part of the Lineará formulary, has no price or certificate of analysis, and is not offered for sale.

No. LL-37 is presented strictly as characterization reference data. It is not a drug, is not approved for any human or veterinary use, and must not be administered to humans or animals.