The compound dataset.
An open, machine-readable reference table for the research compounds Lineará characterizes — name, CAS number, molecular formula, molecular weight, monoisotopic mass, peptide sequence, and research class. Built directly from our verified identifier data and published as CSV and JSON for anyone (or any answer engine) to cite.
Research use only. Analytical/characterization reference data — no efficacy, dosing, safety, or human-use information is included or implied.
Provenance
Names, CAS numbers, sequences, and research classes are stored reference values. Molecular weight and monoisotopic mass are computed from the verified molecular formula (reconciled by construction) and each record labels this with a mass_source field. Where a value is not verified for a compound, it is omitted for that record — never guessed or placeholder-filled.
Purity, certificate-of-analysis values, and any placeholder analytical result are deliberately excluded — they are not emitted in any form. Their absence is intentional until real measured data exists.
License
Released under CC BY 4.0. You may share and adapt this data, including commercially, with attribution to Lineará. Dataset version 1.0.0.
Suggested attribution: “Lineará research compound reference dataset, lineara.co/data, CC BY 4.0.”
Preview
| Name | CAS | Formula | MW (g/mol) | Monoisotopic (Da) | Research class | Sequence |
|---|---|---|---|---|---|---|
| BPC-157 | 137525-51-0 | C62H98N16O22 | 1419.56 | 1418.7042 | Regenerative & Cytoprotective | GEPPPGKPADDAGLV |
| TB-500 | 77591-33-4 | C212H350N56O78S | 4963.51 | 4960.4863 | Regenerative & Cytoprotective | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| GHK-Cu | 49557-75-7 | C14H24CuN6O4 | 403.93 | 403.1144 | Regenerative & Cytoprotective | GHK |
| KPV | 67727-97-3 | C16H30N4O4 | 342.44 | 342.2267 | Regenerative & Cytoprotective | KPV |
| Thymosin Alpha-1 | 62304-98-7 | C129H215N33O55 | 3108.31 | 3106.5041 | Regenerative & Cytoprotective | SDAAVDTSSEITTKDLKEKKEVVEEAEN |
| Semax | 80714-61-0 | C37H51N9O10S | 813.93 | 813.348 | Signaling & Neuroactive | MEHFPGP |
| Selank | 129954-34-3 | C33H57N11O9 | 751.89 | 751.4341 | Signaling & Neuroactive | TKPRPGP |
| Epithalon | 307297-39-8 | C14H22N4O9 | 390.35 | 390.1387 | Signaling & Neuroactive | AEDG |
| Tesamorelin | 218949-48-5 | C221H366N72O67S | 5135.86 | 5132.7166 | Secretagogue & Regulatory | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| MOTS-c | 1627580-64-6 | C101H152N28O22S2 | 2174.64 | 2173.1077 | Secretagogue & Regulatory | MRWQEMGYIFYPRKLR |
| Ipamorelin | 170851-70-4 | C38H49N9O5 | 711.87 | 711.3857 | Secretagogue & Regulatory | Aib-H-D-2-Nal-D-Phe-K |
| DSIP | 62568-57-4 | C35H48N10O15 | 848.82 | 848.3301 | Signaling & Neuroactive | WAGGDASGE |
| PT-141 | 189691-06-3 | C50H68N14O10 | 1025.18 | 1024.5243 | Signaling & Neuroactive | Nle-D-H-D-Phe-R-W-K |
| MT-1 (Melanotan 1) | 75921-69-6 | C78H111N21O19 | 1646.87 | 1645.8365 | Signaling & Neuroactive | S-Y-S-Nle-E-H-D-Phe-R-W-G-K-P-V |
| MT-2 (Melanotan 2) | 121062-08-6 | C50H69N15O9 | 1024.2 | 1023.5403 | Signaling & Neuroactive | Nle-D-H-D-Phe-R-W-K |
| SS-31 | 736992-21-5 | C32H49N9O5 | 639.8 | 639.3857 | Regenerative & Cytoprotective | D-Arg-Dmt-K-F |
| ARA-290 | 1208243-50-8 | C51H84N16O21 | 1257.32 | 1256.5997 | Regenerative & Cytoprotective | pGlu-E-Q-L-E-R-A-L-N-S-S |
| AOD-9604 | 221231-10-3 | C78H123N23O23S2 | 1815.11 | 1813.8604 | Secretagogue & Regulatory | YLRIVQCRSVEGSCGF |
| Cagrilintide | 1415456-99-3 | C194H312N54O59S2 | 4409.08 | 4406.2515 | Secretagogue & Regulatory | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Glutathione | 70-18-8 | C10H17N3O6S | 307.33 | 307.0838 | Secretagogue & Regulatory | γ-Glu-Cys-Gly |
| CJC-1295 | 446036-97-1 | C152H252N44O42 | 3367.9 | 3365.8936 | Secretagogue & Regulatory | Y-D-Ala-D-A-I-F-T-Q-S-Y-R-K-V-L-A-Q-L-S-A-R-K-L-L-Q-D-I-Nle-S-R |
| 5-Amino-1MQ | 42464-96-0 | C10H11IN2 | 286.12 | 285.9967 | Secretagogue & Regulatory | — |
| NAD+ | 53-84-9 | C21H27N7O14P2 | 663.43 | 663.1091 | Secretagogue & Regulatory | — |
| CJC-1295 DAC | 446262-90-4 | C165H269N47O46 | 3647.2 | 3645.0155 | Secretagogue & Regulatory | Y-D-Ala-D-A-I-F-T-Q-S-Y-R-K-V-L-A-Q-L-S-A-R-K-L-L-Q-D-I-Nle-S-R-K |
| TB-500 Fragment (Ac-LKKTETQ) | 885340-08-9 | C38H68N10O14 | 889.02 | 888.4916 | Regenerative & Cytoprotective | LKKTETQ |
| Hexarelin | 140703-51-1 | C47H58N12O6 | 887.04 | 886.4602 | Secretagogue & Regulatory | H-D-2-Me-Trp-A-W-D-Phe-K |
| GHRP-2 | 158861-67-7 | C45H55N9O6 | 817.98 | 817.4275 | Secretagogue & Regulatory | D-Ala-D-2-Nal-A-W-D-Phe-K |
| GHRP-6 | 87616-84-0 | C46H56N12O6 | 873.02 | 872.4446 | Secretagogue & Regulatory | H-D-Trp-A-W-D-Phe-K |
| Kisspeptin-10 | 374675-21-5 | C63H83N17O14 | 1302.44 | 1301.6305 | Secretagogue & Regulatory | YNWNSFGLRF |
| Tesofensine | 195875-84-4 | C17H23Cl2NO | 328.28 | 327.1157 | Signaling & Neuroactive | — |
| SLU-PP-332 | 303760-60-3 | C18H14N2O2 | 290.32 | 290.1055 | Secretagogue & Regulatory | — |
| Dihexa | 1401708-83-5 | C27H44N4O5 | 504.66 | 504.3312 | Signaling & Neuroactive | Y-I-Ahx |
| Pinealon | 175175-23-2 | C15H26N6O8 | 418.41 | 418.1812 | Signaling & Neuroactive | EDR |
| VIP (Vasoactive Intestinal Peptide) | 37221-79-7 | C147H237N43O43S | 3326.83 | 3324.7401 | Signaling & Neuroactive | HSDAVFTDNYTRLRKQMAVKKYLNSILN |
| Larazotide | 258818-34-7 | C32H55N9O10 | 725.85 | 725.4072 | Regenerative & Cytoprotective | GGVLVQPG |
| P21 | 1246751-68-7 | C27H42N6O8 | 578.67 | 578.3064 | Signaling & Neuroactive | D-G-G-L-Ada-G |
| Adipotide | 859216-15-2 | C111H204N36O28S2 | 2555.21 | 2553.5087 | Secretagogue & Regulatory | C-K-G-G-R-A-K-D-C-G-G-D-K-D-L-D-A-D-K-D-L-D-A-D-K-D-K-D-L-D-A-D-K-D-L-D-A-D-K |
| SNAP-8 | 868844-74-0 | C41H70N16O16S | 1075.17 | 1074.4876 | Signaling & Neuroactive | EEMQRRAD |
| IGF-1 LR3 | 143045-27-6 | C400H619N111O115S9 | 9111.5 | 9105.3487 | Secretagogue & Regulatory | — |
| Follistatin-344 | — | — | — | — | Regenerative & Cytoprotective | — |
| Sermorelin | 86168-78-7 | C149H246N44O42S | 3357.93 | 3355.8187 | Secretagogue & Regulatory | YADAIFTNSYRKVLGQLSARKLLQDIMSR |
| Amlexanox | 68302-57-8 | C16H14N2O4 | 298.29 | 298.0954 | Secretagogue & Regulatory | — |
| Humanin | 330936-69-1 | C119H204N34O32S2 | 2687.27 | 2685.4822 | Signaling & Neuroactive | MAPRGFSCLLLLTSEIDLPVKRRA |
| LL-37 | 154947-66-7 | C205H340N60O53 | 4493.34 | 4490.5754 | Regenerative & Cytoprotective | [LL-37, 37 aa] |
| B7-33 | 1818415-56-3 | C131H229N41O36S | 2986.58 | 2984.707 | Secretagogue & Regulatory | VIKLSGRELVRAQIAISGMSTWSKRSL |
| Vilon | 45234-02-4 | C11H21N3O5 | 275.3 | 275.1481 | Signaling & Neuroactive | KE |
| Testagen | 1026993-38-3 | C17H29N5O9 | 447.44 | 447.1965 | Signaling & Neuroactive | KEDG |
| Cartalax | 85806-95-7 | C12H19N3O8 | 333.3 | 333.1172 | Regenerative & Cytoprotective | AED |
| Bronchogen | — | C18H30N4O9 | 446.45 | 446.2013 | Regenerative & Cytoprotective | AEDL |
| Vesugen | — | C15H26N4O8 | 390.39 | 390.1751 | Signaling & Neuroactive | KED |
| Prostamax | — | C20H33N5O9 | 487.51 | 487.2278 | Regenerative & Cytoprotective | KEDP |
| Pancragen | — | C26H36N6O9 | 576.61 | 576.2544 | Secretagogue & Regulatory | KEDW |
| Livagen | — | C18H31N5O9 | 461.47 | 461.2122 | Regenerative & Cytoprotective | KEDA |
| Cortagen | — | C17H26N4O9 | 430.41 | 430.17 | Signaling & Neuroactive | AEDP |
| Thymulin | 63958-90-7 | C33H54N12O15 | 858.86 | 858.3832 | Regenerative & Cytoprotective | pGlu-A-K-S-Q-G-G-S-N |
| Gonadorelin | 33515-09-2 | C55H75N17O13 | 1182.31 | 1181.573 | Secretagogue & Regulatory | pGlu-H-W-S-Y-G-L-R-P-G |
| AICAR | 2627-69-2 | C9H14N4O5 | 258.23 | 258.0964 | Secretagogue & Regulatory | — |
| ACE-031 | 1169766-01-1 | — | — | — | Regenerative & Cytoprotective | — |
| FOXO4-DRI | — | C228H388N86O64 | 5358.2 | 5354.975 | Regenerative & Cytoprotective | D-L-D-T-D-L-D-R-D-K-D-E-D-P-D-A-D-S-D-E-D-I-D-A-D-Q-D-S-D-I-D-L-D-E-D-A-D-Y-D-S-D-Q-D-N-G-D-W-D-A-D-N-D-R-D-R-D-S-G-G-D-K-D-R-D-P-D-P-D-P-D-R-D-R-D-R-D-Q-D-R-D-R-D-K-D-K-D-R-G |
| GLOW | — | — | — | — | Regenerative & Cytoprotective | — |
| KLOW | — | — | — | — | Regenerative & Cytoprotective | — |
“—” marks a value not available for that compound in the current verified data; in the CSV it is an empty cell and in the JSON the field is omitted.