FOXO4-DRI

FOXO4-DRI is a synthetic 46-residue D-retro-inverso peptide (all-D, reversed sequence) derived from a FOXO4 fragment joined to a cell-penetrating TAT-type import motif - distinct from the native 505-residue FOXO4 transcription factor (UniProt P98177). It is listed here strictly as an analytical reference entity — it is not sold, stocked, or certified by Lineará, and has no price or certificate of analysis. The data on this page is characterization only: molecular formula C228H388N86O64 and the values computed from it. No biological activity, mechanism, or use is described or implied.

FOXO4-DRI has the sequence H-ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg-OH. FOXO4-DRI is a synthetic 46-residue peptide built as a D-retro-inverso (DRI) isoform: every chiral residue is a D-amino acid and the sequence order is reversed relative to its parent L-peptide (written here in lowercase to mark the D-configuration, ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg). The construct joins a FOXO4-derived p53-interacting segment to a cell-penetrating TAT-type import motif, then rebuilds the whole as retro-inverso all-D - reading the chain in reverse as L-residues exposes an N-terminal GRKKRRQRRRPPP TAT-type motif. It is not native FOXO4: the human forkhead box O4 transcription factor (gene FOXO4, UniProt P98177) is a 505-residue protein, whereas this is a short designed peptide derived from a fragment of it. The molecular formula C228H388N86O64 is computed from the 46-residue composition (D- and L-amino acids share the same formula and mass) and is corroborated by PubChem CID 167312269; because the all-D retro-inverso stereochemistry cannot be machine-verified, no InChIKey or PubChem CID is asserted on this record and no verified 2D or 3D structure is shown. The published average molecular weight is about 5358.2 Da (Baar et al., Cell, 2017); the peptide is typically supplied as an acetate salt, so a lot's measured salt mass will be higher.

FOXO4-DRI has the molecular formula C228H388N86O64, giving an average molecular weight of 5358.20 g/mol and a computed monoisotopic mass of 5354.9750 Da.

Yes. FOXO4-DRI is a peptide — a chain of amino-acid residues joined by peptide bonds, 46 residues in length. Its identity is defined by that sequence and its molecular mass.

As a research material, FOXO4-DRI is typically handled as a lyophilized (freeze-dried) powder. It is kept desiccated and cold — commonly 2–8 °C for short periods and −20 °C for longer storage — and reconstituted in sterile or bacteriostatic water. This is storage and handling information only, not a use protocol.

No. FOXO4-DRI is listed here only as an analytical reference entity. It is not part of the Lineará formulary, has no price or certificate of analysis, and is not offered for sale.

No. FOXO4-DRI is presented strictly as characterization reference data. It is not a drug, is not approved for any human or veterinary use, and must not be administered to humans or animals.